PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 902029
Common NameARALYDRAFT_902029
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 102aa    MW: 12289.8 Da    PI: 11.5113
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
902029genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding249e-083877445
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     +T++E++l+ + +++ G + W++Ia ++  gR ++++  +w 
           902029 38 MTEQEEDLISRMHRLVGDR-WDLIAGRVV-GRKANEIERFWI 77
                     79***************99.*********.*********995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007175.8E-53482IPR001005SANT/Myb domain
CDDcd001672.91E-53776No hitNo description
PfamPF002493.2E-73877IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-103977IPR009057Homeodomain-like
SuperFamilySSF466892.9E-63986IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 102 aa     Download sequence    Send to blast
MNNTNRLRRG RSFRQTKFTR SRHDSEEVSS IEWEFISMTE QEEDLISRMH RLVGDRWDLI  60
AGRVVGRKAN EIERFWIMRN SDFFSHKRRH FNNSPFFSSP P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2344111e-103AY234411.1 Arabidopsis thaliana hypothetical protein (At2g30420) mRNA, complete cds.
GenBankAY5195201e-103AY519520.1 Arabidopsis thaliana MYB transcription factor (At2g30420) mRNA, complete cds.
GenBankAY6492551e-103AY649255.1 Arabidopsis thaliana hypothetical protein (At2g30420) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002881108.12e-68myb family transcription factor
SwissprotQ84RD17e-61ETC2_ARATH; MYB-like transcription factor ETC2
TrEMBLD7LC502e-68D7LC50_ARALL; Myb family transcription factor
STRINGscaffold_401530.16e-68(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30420.14e-62MYB_related family protein